General Information

  • ID:  hor004016
  • Uniprot ID:  A0A3R7MI09??419-426)
  • Protein name:  pyrokinin
  • Gene name:  NA
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  DFSFNPRL
  • Length:  8(419-426)
  • Propeptide:  MHALTLTVAALTFLSLAKCSTLTAADTQDALPGYQPRDFSNLAQDDRSLRMFLDFLLNSQQPSPMMGEPLEDSDEGYRRKRSVNTSQEEDVRKEENEETRDKRQTKEEKDEEGETAEEQSGSWWWRPVEERRSYFIPRLGKRDGNDIPALASENDLDNMEYLDDDEVDSGDAEALREEEDPTGEVEKDEDEQDAWAGFGSPLDKRDFAFNPRLGKRQTFTPRLGKRDFAFSPRLGKRDFAFSPRLGKRDFAFNPR
  • Signal peptide:  MHALTLTVAALTFLSLAKC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3R7MI09-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004016_AF2.pdbhor004016_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 112013 Formula: C46H66N12O13
Absent amino acids: ACEGHIKMQTVWY Common amino acids: F
pI: 6.34 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -56.25 Boman Index: -2280
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: -1370 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19852991
  • Title:  Combining in Silico Transcriptome Mining and Biological Mass Spectrometry for Neuropeptide Discovery in the Pacific White Shrimp Litopenaeus Vannamei